DPCstruct | MC37145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085Z3M6 | 1-133 | MDTINTITDLRNYIPTTHDTCCLLGYYIKGDKEPLIYIYKAGTFSDNGGNIIVPTGANGAWIAELQDEVNIKHFGAKANDINFDNSI… |
| A0A5B9FTT6 | 18-140 | SIVDTITQLKNYKGSNKIVYVQDTVQGGIFNYVTGLVKDDGVVFDAIGMGSGFWQRDLTPSPTIDVQWFGAKCDGVTDDREALLKAI… |
| A0A7R6SVG0 | 85-243 | None |
| A0A5C4SXU7 | 93-269 | None |
| A0A5C4TAI6 | 101-263 | None |
| A0A7X2HR94 | 6-147 | None |
| A0A0E3ZVH2 | 203-333 | None |
| A0A6F9NTQ4 | 3-87 | None |
| A0A4Q2QZ62 | 218-359 | None |
| A0A4P5Q9V2 | 133-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.