DPCstruct | MC3714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X7H059 | 7-88 | QALRERYSPAPVPKCPICGEEMSIQRISGAQVVYGCSGYGDDGDFKIGRTLADEHYEKSRVTVLDVGDPEVLALLDWLETKD |
| A0A7Z7PK03 | 1-93 | MSEINYQALRERYSPVPVPKCPICGEEMSIQRISGAQVVYACSGYGDDGDFKIGRTLADEHYEKSRVTVLDVGILKYWRYLIGWKPK… |
| A0A747SU54 | 2-90 | None |
| A0A6P2FYR6 | 1-100 | None |
| A0A5Y2NZR8 | 6-93 | None |
| A0A5R9NZR8 | 10-114 | None |
| A0A5U4G104 | 1-96 | None |
| A0A601WIK9 | 2-88 | None |
| G9Z9C7 | 7-94 | None |
| A0A6G6JMI2 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.