DPCstruct | MC3713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 109 ± 26 aa |
| Standard deviation of domain lengths | 25.52 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0219- PF14706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1ZSA8 | 3-82 | NREEAEKVSCEVYLDTLSWKLLFKATNQKAPMPKEAPSLKWAYYAISKLGGWHDSKRTGRVGTKAMWDGWVKLVFLVESY |
| A0A7X1VVH7 | 23-124 | NALAIDMIIAWRIHYLTTLGQETPDVPCTVYFSDSEWKALTTFANKVKEPPDLPPSLNDAVRLLGKLGGHLGRRGDGHPGSEVLWRG… |
| A0A347UV27 | 1-123 | None |
| A0A218QQP1 | 114-199 | None |
| A0A6J4EJ09 | 61-223 | None |
| A0A7Y5SHN7 | 3-111 | None |
| A0A6I1W793 | 1-74 | None |
| A0A7W1GUX4 | 62-178 | None |
| A0A7K2CES9 | 28-124 | None |
| A0A7W6Q9L0 | 109-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.