DPCstruct | MC37129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 259 ± 33 aa |
| Standard deviation of domain lengths | 33.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077KI60 | 1-257 | MNTAPDAMYAYEQLYKAGRSGLRQNTQALQAYSNAIKNNKLRELGFSDELLARVNGYNPAAYDEILTDLDKLGSTLQRNNTKLENFN… |
| A0A7W3VJL6 | 1-224 | MGLTDDIIGSFQGYSTSTRSASYAEVLDDFNNFGKFIATNSSTSLENFDKIVNVFKRTDQVGNNYKQGVHWMIRDLNMNGSIFVGKK… |
| A0A250FX68 | 245-480 | None |
| I9E516 | 699-1020 | None |
| A0A316ERQ4 | 672-924 | None |
| I4A2J9 | 152-405 | None |
| A0A385SG01 | 685-982 | None |
| A0A023BMZ3 | 2-332 | None |
| A0A563D994 | 153-393 | None |
| A0A5M4B999 | 821-1046 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.