DPCstruct | MC37128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 179 ± 33 aa |
| Standard deviation of domain lengths | 32.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 82.51 |
| Assigned Pfam label(s) | PF08771- CL0020- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815EE10 | 5-206 | FKKTSKQIDEAIEQLKQPITLSNPHSCWLQLRQLYSMLHRTGKRSGTIHAMNQISPKLAEIKHSVIPNPGEDGQFHTIYSVCQTVQV… |
| A0A3P6PLY6 | 17-181 | LKELNQAWDLYYIVFRKISNQLRQLTSLDLNYVSPKLMKAQNLELAVPGTYDPKGPLITIASVGSKLQVISSKQRPRKVTIKGSDGR… |
| A0A6A4GUD0 | 337-512 | None |
| A0A0M3IWS3 | 4-164 | None |
| A0A1I8FRI9 | 34-219 | None |
| A0A820W1Q8 | 429-580 | None |
| A0A1I8FUW8 | 212-390 | None |
| W2PGJ4 | 542-735 | None |
| A0A183M8W7 | 39-209 | None |
| A0A3P8E7G5 | 485-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.