DPCstruct | MC3712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 207 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I2SNP8 | 3-201 | RHAKVAEAEAKEKEAEAALTQAKADNKMTQQEHDDLAAKNDAVTAAKADAAKAVEGLPAGDAKDGLNGRLAKVDGIDVPAVDENGNG… |
| A0A7U2VUR7 | 1-191 | MNDQDGNGKADAEEAAAAVAAATEKVEAAEAADKAAKDKLAELNADKLITPEEKAQLETAKQNADTLKGEADSAVKALPDTAAEKGG… |
| A0A8A6QPV1 | 637-876 | None |
| A0A376ZSY6 | 552-776 | None |
| A0A7T3T4F2 | 615-810 | None |
| A0A833PCA5 | 22-215 | None |
| A0A2D1IPT0 | 212-419 | None |
| A0A8B1KQ79 | 38-245 | None |
| A0A380IXW2 | 1-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.