DPCstruct | MC37118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 25 aa |
| Standard deviation of domain lengths | 24.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6AG44 | 1-146 | MSSAGDVIVARASNPLAFNSEFPAYVVICALLTIFFLLYFNRLFASIVSYAIRAITWHRYRIYIDVKALQLSLLGGRIFFTGLRYHG… |
| A0A0H5C1N7 | 13-144 | TNTLDLSWVFVVDWILALVLSIWVIFHFNRLMGFVISWSLENTLWRHGQIKIDVQSVKLSLLGGRLFFKNLTIIDKDYTVAVVQGTF… |
| A0A168DH76 | 11-166 | None |
| T5BPK4 | 2-186 | None |
| A0A0M8MQX5 | 9-145 | None |
| A0A504Z1D0 | 2-140 | None |
| A0A077ZPV1 | 9-163 | None |
| A0A5E4DAL3 | 1-174 | None |
| A0A2M4DP98 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.