DPCstruct | MC37117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 247 ± 28 aa |
| Standard deviation of domain lengths | 28.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6AFF8 | 1-246 | MAAVCKLGQLILDYESAVKDLEKAARLRYNGWNQRYNIIRDYFESDEFKSTLQNRATLEFAASIFALSDLRAWLYAGKIQAKRKTTT… |
| A0A2A9P4S9 | 317-553 | YWTAVHKRDDAWDSHYKNMFLPAIKSKIYQDKIQDLLSATVATQIYALADQAGRMYAAGVAAVENSNSVEELNLALGSTKDGWAKAW… |
| A0A2C5XSS9 | 1-283 | None |
| A0A2C5Y3W4 | 262-553 | None |
| A0A369GP23 | 332-552 | None |
| A0A2A9P7Z0 | 628-843 | None |
| A0A2C6A7Z5 | 898-1161 | None |
| A0A2C5XN38 | 94-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.