DPCstruct | MC37116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 422 ± 41 aa |
| Standard deviation of domain lengths | 41.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.67 |
| Pfam Score | 92.46 |
| Assigned Pfam label(s) | CL0532- PF06011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6ABL0 | 2-408 | QTLLRSSLLLAAALSPVAKGEKLLMSKSLNTCQEESGFSASLFDVIYTPENNSARINLDALSTIQGKVVIDLAVSVYGYPVFSTVID… |
| A0A2C5XGN8 | 6-436 | HVDVTNCLPDSYRSVTPARLQWQPLHAEARFDARGGRYNLEFVVWGNVTGASPGQPAPPPAGDAYWSNPNKTNGKIIETPDPDAENK… |
| A0A423X345 | 277-673 | None |
| A0A4Z1H714 | 12-437 | None |
| A0A1L9WQC0 | 5-346 | None |
| A0A3D8QAN8 | 6-450 | None |
| R1FWC4 | 3-419 | None |
| A0A5N5QI53 | 211-651 | None |
| A0A1V6Y4C5 | 164-632 | None |
| A0A094IPE6 | 225-665 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.