DPCstruct | MC37115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 101 ± 21 aa |
| Standard deviation of domain lengths | 20.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6AB84 | 8-127 | PSSVSPSPQPPPPEWLISALKQLEKQYPSGDKFEAIMKYSYLDPVTELPIQGQPLPEGVKYAWLPRIRCLDCTTKLYTPGPDMTAQK… |
| A0A2V1E4F7 | 74-175 | QHPPPPLWLQEALQELRGENPSDLFEAIMRYSVIDQNTLQTVRRDSLSASDVLPPGYKAQFLSRIRCIDCPGKLYNPGPDHTVGNFQ… |
| A0A0C9UFG9 | 15-98 | None |
| A0A370TB95 | 542-647 | None |
| S9W284 | 483-579 | None |
| A0A094J5C2 | 246-366 | None |
| A0A4Q9NQ93 | 1-70 | None |
| A0A1J9QW13 | 678-815 | None |
| A0A146HA56 | 224-338 | None |
| A0A433Q7C9 | 76-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.