DPCstruct | MC37113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 348 ± 57 aa |
| Standard deviation of domain lengths | 57.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5AA25 | 34-329 | LRRFDRDDPPPYASSTDSERLDESLPRLSQEDIEALLDPPCTDEERYWVANTMQSSLSPGELYYEECRFEAVRLERYRFRHMIFRGK… |
| A0A2C6A918 | 18-329 | HSEPPPYQSPLRNGDDDDQLSRSPSAAGQTAVALDEARLAEPLNAEELYVLQSMLESQYHAYQPGVRYLQEAEEEKRYMQLLREESD… |
| T5AMB0 | 2-407 | None |
| W9X904 | 1-349 | None |
| A0A2V1DXI4 | 2-356 | None |
| A0A428UB05 | 1-296 | None |
| A0A1L7WCP8 | 4-469 | None |
| A0A545UV21 | 2-338 | None |
| G3JAN5 | 12-404 | None |
| A0A6A5YCH2 | 1-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.