DPCstruct | MC37112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 155 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08518 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6A951 | 86-234 | YSGRSEGNRNSTRTDIDDSVLNEHYLALKTFLNSRDANSRQQPNKARDKLLRLSSVQFHELSTDVFDELVRRQASARAPPNAPNAPP… |
| A0A194UWH6 | 73-219 | VDGRLEKDTDPVRVDQNDTEELLRERYYILENYLGTSPYGMHVGASSGHALAKIRRLTSSQLFEFSTDILDELYRREPSIQDPSQVP… |
| W4KIY2 | 101-237 | None |
| A0A1R0H3A2 | 5-143 | None |
| H2AZW7 | 5-180 | None |
| A0A179I3M9 | 6-172 | None |
| A0A6G1I7E6 | 97-273 | None |
| A0A397S5J2 | 2-139 | None |
| H8ZG31 | 48-187 | None |
| A0A2H9TGR6 | 5-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.