DPCstruct | MC37111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 29 aa |
| Standard deviation of domain lengths | 28.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1LQ98 | 162-346 | KAEDIKNLDQFVAEIRDPANWVLPAVPKTSYSISKFQGILLKALPLEAGVNTSDLDAVERNTEYRASISFIINGQEASYSLFTNPVF… |
| A0A2C6A806 | 1-212 | MRADDVLSMASRSAPLGPPAASYPVADYGLVAPLTESGFVVDAVRIELLGFKPAEATATSIETTTPLPPPFDATVQFAIDGLSWPLR… |
| A0A0U5GRS4 | 711-901 | None |
| A0A2B7WMY7 | 591-786 | None |
| A0A0D2IQG3 | 709-879 | None |
| A0A0F8XUC0 | 932-1147 | None |
| A0A0M8N968 | 468-689 | None |
| G4TH71 | 731-888 | None |
| A0A4T0VX07 | 765-945 | None |
| N1RD20 | 249-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.