DPCstruct | MC37109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 135 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 13.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6A317 | 164-258 | PAREQRGNQGPRQAGGRFRTAADVINRLRWDRTMDAGDYVVGYRDRFAGVRERALDEWTGEQTHDDFIPQHRIVHFKRRSDGVVVWE… |
| A0A1D2R4J0 | 11-81 | MEKDALNRIMWDPKLNPDDFEICYADRSELKRVNFSDIRVDGDFMVMGDKIIPVHRIRKIIRKGRVVWDKR |
| A0A397JAH3 | 3-86 | None |
| A0A2H6JUZ3 | 2-78 | None |
| A0A2B4SJJ1 | 200-307 | None |
| A0A7S4E6E5 | 18-114 | None |
| A0A1J9S668 | 198-321 | None |
| A0A067BRU7 | 1-90 | None |
| A0A067C3U6 | 45-142 | None |
| A0A821GF55 | 125-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.