DPCstruct | MC37107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420Y874 | 1-62 | MEPKDHPNFDDLPQVEGFPQGCAWGIFDRAGKKDVYGTLNFLTPRVVQAAAAEVKDGISISL |
| A0A2K0TDT3 | 1-62 | MAAYEFPDFDQLPSVPGQPQGSLWGFFDRGGKKDELGTINLLNAETVKEAAREIQTGRHVQL |
| C9SAE6 | 5-74 | None |
| A0A0D2FWM9 | 258-323 | None |
| A0A0G4L3C8 | 2-54 | None |
| A0A1B7XXJ1 | 1-63 | None |
| A0A2H1GAA0 | 29-89 | None |
| A0A317A797 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.