DPCstruct | MC37106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5Z8H5 | 492-579 | PCEEFSKLKVFLSLSSTDWAGTYDSVAARIGNQDIFFFTGPSPGAEKWVDVDLNLAFGKHVVPLSEVKSIDLVDTAVGYYVERDAWKY |
| A0A2C5ZTM1 | 299-419 | IEVSDRPDAPPKPRSRWEWTNQTRDRLCPYVDQLRVHIGLAADSGAGTYDTLALALYDLRTGREHMQELVAGPGAGYAAWADVDIRR… |
| A0A369GEW0 | 4-118 | None |
| T5ACC6 | 280-374 | None |
| A0A167TMB6 | 467-557 | None |
| A0A545ULP1 | 1-110 | None |
| A0A545UP54 | 539-625 | None |
| A0A6A7Y9Z7 | 3-111 | None |
| A0A369GJH7 | 487-583 | None |
| A0A2C5YGB8 | 14-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.