DPCstruct | MC37102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5XLL9 | 2-138 | AVPYSRARDFARAGYAALVTDEGAVGGVTRQLGNFSFTRVFQAGHEVPAYQPAAAHAIFRRAIFDRDVATGLLPVRDDLATVGPRDS… |
| A0A507AVA9 | 874-1018 | CNWLGGEAVSRAINYTHTKDFNAAGYASIQTNASLVGGQVRQYGNLSFSRVYQAGHEVPSYQPDTAYEIFMRALFNKDIATGKVDTL… |
| N4XQ10 | 753-892 | None |
| A0A7D8YVQ8 | 130-252 | None |
| A0A0G4MPT4 | 458-600 | None |
| A0A4Q4W3N8 | 111-260 | None |
| A0A0D2DYV5 | 145-279 | None |
| A0A4R8Q6R6 | 654-789 | None |
| D4D280 | 77-214 | None |
| A0A2V1BAN7 | 34-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.