DPCstruct | MC371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1EAM0 | 2-121 | ANIDAAAVKQAVQRHPDFIVGLKARMSSSVVGENGITPLARAKAIQQENDDLPLMVHIGNNPPNLDEIADLLSSGDIITHCYNGKPN… |
| S0JE04 | 19-138 | SKIQEELVTQALQQFPEFIVGIKAHMSKTVIGTNGITPLELAKKIQQKNAVPLMVHVGSAPPELADILEVMEAGDVLTHCFNSKVNG… |
| A0A0D8FW33 | 128-241 | None |
| A0A485AP34 | 2-100 | None |
| A0A433Q823 | 119-259 | None |
| A0A3B0MHC3 | 339-476 | None |
| A0A447JPJ0 | 2-122 | None |
| D2U2R0 | 2-121 | None |
| A0A3R6P6Q9 | 260-390 | None |
| A0A2E7D3P1 | 40-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.