DPCstruct | MC37099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 262 |
|---|---|
| Mean domain length (aa) | 77 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0673 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4QCD2 | 35-117 | QMQTPTASMPQNVVLNSVNNGVYYVVLDGKQAGPFSQSELSRLINEKKVTKDTFVWKPGMREWLTAENIPDVLKLVALMPPEI |
| A0A060D7Q9 | 27-85 | IWYYRDRLNISRGPCDIYLLRKCWINGIIDQNTLIWGIGLDDWVPLRNIRNLIILIRIP |
| A0A2G4IVU7 | 31-107 | None |
| A0A142X0V3 | 1-79 | None |
| B9XGP6 | 2-55 | None |
| A0A832H4Y7 | 181-252 | None |
| A0A166S3K5 | 1-66 | None |
| A0A6G4WGZ4 | 2-73 | None |
| A0A370H5Z6 | 99-173 | None |
| A0A355S9M4 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.