DPCstruct | MC37091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VUK1 | 5-159 | QAQVGSWEADISDLQQDVVVIQQELIRQQHFRGYYLTIQEIYNLPNAADGDYAYSAEDLQEYIYDSQSPQLIKWVQSGHTVPDQLAP… |
| A0A5J4W9Q4 | 4-144 | QINGYSQDIGQLQADVSVINTELARQTHFRGYFATNDEILALTDVSRGDYAYCAEDLLVWIYDTSWYETDQIVPDQMTPASDANPQA… |
| A0A5J4VPQ4 | 9-144 | None |
| A0A5J4TNC2 | 2-111 | None |
| A0A5J4V4Z4 | 79-238 | None |
| A0A5J4V3N2 | 3-130 | None |
| A0A5J4V305 | 138-317 | None |
| A0A5J4V1S7 | 36-185 | None |
| A0A5J4W0A2 | 119-281 | None |
| A0A5J4VEB4 | 36-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.