DPCstruct | MC37089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4V5Y0 | 508-587 | MKIYNNSADKFGQSLYIVMTKVVDFCQYGILGEYVKGNYSDVYSDENDLEGIPKNLNDFYNLSQEEIEQQSQPLEPLWRI |
| A0A5J4TW04 | 47-126 | MLIYKNNAANGGNSLYVVMAQLKEWCQAGNEGEHVKGNYSEETSQLNDLQGIEVGADQFDKLSLDDIKSQQVFLECYWSD |
| A0A5J4UWD0 | 336-422 | None |
| A0A5J4X8P9 | 71-150 | None |
| A0A5J4WAX9 | 57-132 | None |
| A0A5J4VGI5 | 416-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.