DPCstruct | MC37087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VG95 | 66-168 | RDIKQFKVHNMPMTEAKKNIMKVSRSPIDDFIIKRYDQLVEGVECAIVKGWRPTSYIEKYFITDIGKYCDRKQRRVSGIVKGVYILK… |
| A0A5J4R0F6 | 38-140 | LDISQFNLKDIPMTQVKKDIIRASISPVDDVIISHFKSFRDEVTCNIVEGWKPQDMKLKNYLLTIKSICERTQKQVDGVRKFIYKIK… |
| A0A5J4U9Q2 | 420-515 | None |
| A0A5J4TX42 | 1-95 | None |
| A0A5J4V4G8 | 868-980 | None |
| A0A5J4V312 | 116-228 | None |
| A0A5J4UZ70 | 1-93 | None |
| A0A5J4UV44 | 10-108 | None |
| A0A5J4UM16 | 105-219 | None |
| A0A5J4UAX7 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.