DPCstruct | MC37086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4QDL3 | 1-145 | MSYKDYAQQQHDRIYGVQINDGFTLLDMQEKAANGEYENEEQIVMDLTRLLVYYEGETEDIYAIKGYDAICDTQVLYHKLEGTVYKQ… |
| A0A5J4WY21 | 7-123 | IDINDSFIFGNISEKVTRGEYKQEVDIATDLTNVIRYYAGESGLVFIIKEYDAQQETNVIRQKTKTNAYEQMHIIRLWDDGKKHITV… |
| A0A5J4UWH5 | 2-96 | None |
| A0A5J4U9Q2 | 247-366 | None |
| A0A5J4V4G8 | 489-640 | None |
| A0A5J4WDQ8 | 2-114 | None |
| A0A5J4X2Y6 | 1-129 | None |
| A0A5J4W246 | 100-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.