DPCstruct | MC37085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4VV05 | 193-284 | QIVRPAAIKDDLLWNLLQRIFTIDKKDRPTAEQVLQDPYFTGEQALNEVSAEAKQITAASLTAQQNGDESINKYDINELYTVPKSEI… |
| A0A5J4Q8K7 | 1-95 | MKSIGRLSEIKDDILWDLLSKLLEFNPDKRITADEALQHPYFTSPEAYADISKEQQDLASQAEVAESQGNSMITEFDKDPTFIVEQS… |
| A0A5J4VYH3 | 236-340 | None |
| A0A5J4UDJ3 | 72-156 | None |
| A0A5J4UI93 | 3-97 | None |
| A0A5J4UCD2 | 92-170 | None |
| A0A5J4ULC7 | 2-86 | None |
| A0A5J4UNW4 | 258-343 | None |
| A0A5J4TTM9 | 113-203 | None |
| A0A5J4UUI3 | 87-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.