DPCstruct | MC37083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 135 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4UUZ7 | 491-633 | MKQMYGTSSEMTGNAEIKIIKNNDNNKENGKFGWISTFEGIQLHLYSLNIIMDNSQLLIPIIYIQDSNSLLELNTITFTGIKLSPTT… |
| A0A5J4PQ29 | 1-120 | MYGTPSEMQGQAEMKIMKNNDNNKENGKLGWISAFEGLQLHLYSLNIIMDNSQLLIPIIYIQDSDSVLELHTITFSEIKLSPSTESK… |
| A0A5J4UKB7 | 1-146 | None |
| A0A5J4U7P2 | 340-482 | None |
| A0A5J4UZ93 | 409-554 | None |
| A0A5J4UFF1 | 144-267 | None |
| A0A5J4WTB1 | 1-136 | None |
| A0A5J4W3T4 | 153-297 | None |
| A0A5J4WV74 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.