DPCstruct | MC37079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 229 ± 48 aa |
| Standard deviation of domain lengths | 47.56 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534V4N0 | 11-220 | INVYAKDIGLLPDWQQKVWSGYNISPEGKVSEELLASQIKAVPAKTRAPESLLAESLSRLNYVAKAKLRIAIVREHDQIPNLIARVH… |
| A0A523RKW5 | 167-327 | EKKFIISKIIEKVDSINSLMEQNYKIKLFVIQEQKIWNNLFEPCEDRKDFVLYITALSSLVDWINIKKLKDSLKIEPKTGSINYLER… |
| A0A0F9QU41 | 794-962 | None |
| A0A246EQ96 | 125-413 | None |
| A0A6I1KE65 | 128-297 | None |
| A0A3A1P0S3 | 115-371 | None |
| A0A7C3AKA0 | 40-235 | None |
| L9YYV3 | 20-269 | None |
| A0A3E0GSQ3 | 169-404 | None |
| C4ZIE2 | 87-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.