DPCstruct | MC37073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 213 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2DF93 | 76-287 | AYLGLFAFFSSILNPFIEKAYFERGRVVSSASNNIYTIDFNADYNVIKKRMGVGENTRLEEFQADFEQTGIIKRLTYKFLTIDSKGT… |
| A0A426GYH9 | 1-209 | MDDWESRPIFIEHELGSVYTMNFQEEYELVKQELNLENNSLRLEDFEVDYTEDGRITDLSWQLLGQNGNSYNLYEIRYDIDKNRYQV… |
| F7KRI3 | 209-466 | None |
| A0A386PHU1 | 2-227 | None |
| A0A1S2LF24 | 4-204 | None |
| W6S0C2 | 13-238 | None |
| A0A3A9ARP0 | 217-400 | None |
| A0A1F8LPK0 | 29-216 | None |
| A0A1Y5K8U0 | 282-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.