DPCstruct | MC37066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 159 ± 31 aa |
| Standard deviation of domain lengths | 30.72 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1QI44 | 97-298 | PSSSAATSRDLHNTAPNPRAVPWNSSITSLNFNYLPPPLPAITPVTPAQTRNCAYDPKHPLNIYAHRRIEEWKHNAFNWTVTVPVSV… |
| N1Q8H9 | 165-330 | MSHMYEPFPKPINVTTFLQTKIFASDQYNPKSIEIRRRFKAFDPKSFIWVVRCPVSVSKKSTYRHLVEKKVRRAFRAALENEGYSDD… |
| A0A135S6Y6 | 109-260 | None |
| W2RVY1 | 5-135 | None |
| N1QM18 | 43-233 | None |
| S3D4V1 | 254-419 | None |
| A0A179IJ25 | 40-266 | None |
| C4JH84 | 43-196 | None |
| A0A0M8N0R3 | 89-194 | None |
| A0A162NWK8 | 104-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.