DPCstruct | MC37065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1A2Y1 | 1-80 | MRFNIRELVAQADDAAVDYPYVDPASGELRTAVCSRVYHINLVLKYTYFDKEEQVTIHYERIRIVVGKDGIVRLEEVRVA |
| A0A645I220 | 1-71 | MRFHLSRFMQKTDNPEEAIYYLNEEGESVEIYGDKIYYLNILMQLQFEDQVNYKRFRVSFTRAGIIRLEEL |
| A0A655XMF2 | 6-81 | None |
| A0A7Y0RQ68 | 38-113 | None |
| A0A2G6HLI2 | 15-92 | None |
| A0A847N4G1 | 68-142 | None |
| A0A3D1X5R7 | 112-189 | None |
| A0A655ZB69 | 80-155 | None |
| A0A3L7X6D2 | 186-258 | None |
| A0A3T1DKR9 | 127-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.