DPCstruct | MC3706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 99 ± 20 aa |
| Standard deviation of domain lengths | 19.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538IUJ3 | 139-272 | MPRYEILDEAAMQELERGWRRIVSELGIEFLHEESLDYLRGAGQQVEGQLVKFDPDWILEQVAKAPSEFDLQARNPERTVHIGGKHM… |
| A0A497JXP5 | 2-96 | INLKLNVLSRDEVESIHLAVLQVFEKTGVKIYSERARRMLKEAGAEVDEKTYMVKIAPYLVEESIKNAPKYIQLYGRNTSYRLKLEK… |
| A0A7Y8J1R0 | 1-89 | None |
| A0A7V3K136 | 35-131 | None |
| A0A7C1RR24 | 1-76 | None |
| A0A1F7CME0 | 3-67 | None |
| A0A7C3DZ33 | 1-128 | None |
| A0A532TVP4 | 1-102 | None |
| A0A2E8H639 | 5-99 | None |
| A0A7C3HX90 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.