DPCstruct | MC37052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6RCC1 | 6-104 | PSVNMILPYAAPRLSGCSREALYEFSVCCIENSRDLLQVLETEYRSQFARNLTLSRLSEAVILPLCPDKGSCMEYDENLAASVYLEN… |
| A0A645HIX8 | 20-138 | YPFISGDGIEDANLIGSMIPSINLILPYTSPHYIKDTNAHDLYNFSMTCLENAYAILKSLEEVYEELFERRLTVSALNEVLVYPRVV… |
| A0A645GAJ8 | 45-160 | None |
| A0A7C7E626 | 607-727 | None |
| G9YEW8 | 1-88 | None |
| A0A7U4JQF6 | 1152-1271 | None |
| R7AG37 | 704-835 | None |
| A0A645BCN4 | 384-504 | None |
| A0A7V6FEV1 | 958-1075 | None |
| A0A3D3TQL5 | 334-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.