DPCstruct | MC3705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1315 |
|---|---|
| Mean domain length (aa) | 237 ± 58 aa |
| Standard deviation of domain lengths | 57.82 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 13.60 |
| Pfam Score | 79.83 |
| Assigned Pfam label(s) | CL0022- PF07005- CL0015- PF06140- CL0396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1F0A6 | 49-197 | LIETQGETAQALAIRLARPVVVVDKMAGKVVTIAAAAVNPDSATRKAIYYLQQQGKTVLQIADYPGMLIWRTVAMIINEALDALQKG… |
| A0A497JMG7 | 5-241 | SNSLKVCVVGLGNVGHPTASYIHENGYLVYGYDIDPQKTSQINPITAFCEWEKVPECNIYVVCVNTGWKNGKPDMSNVFDACQKIAE… |
| A0A7R9Q0K2 | 385-677 | None |
| K9V1H0 | 1-233 | None |
| A0A446J143 | 185-397 | None |
| A0A3Q4HAT9 | 24-280 | None |
| A0A438MX65 | 19-305 | None |
| A0A0H2M8Z8 | 1-196 | None |
| F4Q5M4 | 2-193 | None |
| F4PS83 | 499-790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.