DPCstruct | MC37043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 146 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3J4Z2 | 78-220 | SGSPKIGEIVLCLFRKHFLVGCLVETRRNGRLVLVTKDQRNIVVRRNTIVYLTGVSVGNDRGVLHTYASSVRGVAEHIDLVEIWQLF… |
| A0A2M8V7L2 | 1-111 | MYVFYEDDGSFKAGHILSETDASLQVESESGKRSKIKRANTLFNFASPDPATLMSQAAATAETLDLQFLWECAPQEEFDSPALAADY… |
| A0A7C0YBP2 | 37-166 | None |
| A0A5S9EZ71 | 3-146 | None |
| A0A498IGY9 | 490-665 | None |
| A0A6V2IF02 | 47-213 | None |
| A0A6S7ATM8 | 1-111 | None |
| A7BS42 | 3-148 | None |
| A0A7S0BEG0 | 15-165 | None |
| A0A2S6QLT0 | 3-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.