DPCstruct | MC37039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 65.81 |
| Assigned Pfam label(s) | CL0229- PF12451 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BV02 | 15-78 | MKREIEDLKTNAKVFQLSKCTACTFTLDLPAVHFMCMHSFHLRCLGDNEKECPECAPEYRSVME |
| A0A822Y836 | 1-63 | MRKEIQDLRTNARIFQLSMCTACTFTLDLPAVHFMCMHSFHQHCLGDNEKECPECAPEYRSVL |
| A0A0G4KT86 | 469-534 | None |
| A0A0D8X9D6 | 1-57 | None |
| A0A397F5D7 | 346-408 | None |
| J4UDN5 | 912-977 | None |
| A0A0R3UQS1 | 29-91 | None |
| A0A2W1BS46 | 559-625 | None |
| A0A0B1TKF4 | 35-92 | None |
| A0A0C2JHD5 | 53-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.