DPCstruct | MC37037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Standard deviation of domain lengths | 15.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.76 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0061- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2ZWQ9 | 2-112 | KERCVVVIPGWELMSYFSDKTNVCWFLQQDLAEAIKALHCEIGNAATEERYIVVGNGSSQLCQAALFALSSLSEDKPLSIVAAVPYY… |
| A0A822Y5L4 | 6-120 | PSDFVINLDNGDPKMSKPYWQKMGDKCTVVIFVWQSLSYVSDITNLCWFLESELAEEIRRLHYLVANTETEGRYIVVGTGSTQLFQA… |
| A0A453E2Q6 | 65-178 | None |
| A0A2N9IMS8 | 57-177 | None |
| A0A452Y435 | 56-173 | None |
| A0A068UUY3 | 78-171 | None |
| A0A6D2JTV7 | 184-306 | None |
| A0A218WUA7 | 9-140 | None |
| A0A4Y7J374 | 53-160 | None |
| A0A2G3ANJ2 | 102-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.