DPCstruct | MC37032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0VTQ6 | 427-538 | ILSQYCESWSKDETQRVYIAELGIPVEWMHDALALYNEYYGDQQSALENYILCGNWKKAHTIFMTSIAHSLFLSSKHQEIWDITSSL… |
| A0A822XUJ0 | 1-111 | MQRQFIEDLGVPSAWLHEARATYYHYYGNMSKALEYSNWQRAHLIFTTSVVHTLFLSANHPELWRLAHTMEEYKSEIADWDLGAEIY… |
| A0A4Z2EJK6 | 154-280 | None |
| A0A803LHV1 | 288-422 | None |
| A0A835UCH6 | 592-699 | None |
| A0A1R3G4B3 | 605-726 | None |
| A0A3P6A723 | 320-437 | None |
| A0A803P097 | 835-956 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.