DPCstruct | MC37028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 3 aa |
| Standard deviation of domain lengths | 3.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BLH7 | 113-203 | DNLSNRQKPGCGKGSAVDRSREQTTGAVKKKLKERMDDFQVLRESIRQEYREVVERRVFTVTGNRPDEETIDDLIETGRSEQIFKDA… |
| A0A822XIV0 | 1-96 | MDCTNAANRRLSGYKEGTLMDRTRTSVTIRLQKKLKELMDFQELRQRMMVEYKETVGCRYFTVTGKYPEEEVIDEIISSGAGTGGEE… |
| A0A453BCW7 | 112-206 | None |
| A0A7N0V4S0 | 85-175 | None |
| A0A7I4DN70 | 58-148 | None |
| A0A2U1P6M9 | 108-198 | None |
| A0A445E918 | 20-113 | None |
| A0A287VAM4 | 25-115 | None |
| A0A453K1K9 | 59-149 | None |
| A0A843V1T9 | 72-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.