DPCstruct | MC3702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8GLJ2 | 9-117 | APPELVAMSAYYDQVIGSPITFLEALRLFSQNKGYSIDYHTVELSLEMHPLEDDYFPDGVRFSVDVPHAYEAEVIVSYKIFYYYLSK… |
| A0A0W0IAF3 | 3-87 | KKFLYGLSLMAEGVGFCFDETYFHFPDLESSGDELRFEGLMFGVFDEEVIVSEADGYNLARLACNKYLQLHPEDTSKVNELLTKL |
| A0A399WAV3 | 2-78 | None |
| A0A0Q8IQK4 | 2-88 | None |
| A0A022PCF0 | 89-187 | None |
| A0A2S8F314 | 23-107 | None |
| A0A1M6ZUC5 | 18-124 | None |
| A0A846V4F6 | 21-115 | None |
| A0A4Y3PU99 | 2-82 | None |
| A0A212LZU4 | 27-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.