DPCstruct | MC37016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19379 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2ME33 | 193-329 | FGPIPGTMPEQVEAEARHACRTHPGIVMLPPTFSIVEVTPEGGWEPLTGGHGPAEAKERLSGHFTQLLPMLREFQGDPASPEELADW… |
| A0A850JMX0 | 21-161 | EHVPEGPSVPAEMTRDARRARATHPRVARLPTRFAVAEEEGGRWPAHGPFLHSPAAVREHLAAYFDLVVPLMPGSSPRDLAAGREAA… |
| A0A345SRJ8 | 192-326 | None |
| A0A6G3D048 | 13-157 | None |
| A0A150VMI5 | 192-316 | None |
| A0A495QTS9 | 12-130 | None |
| A0A7K2IIY1 | 50-203 | None |
| A0A7W8VDI9 | 136-292 | None |
| A0A0N1JWJ8 | 18-131 | None |
| A0A6I4PCD4 | 19-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.