DPCstruct | MC37013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 144 ± 26 aa |
| Standard deviation of domain lengths | 26.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3NPI7 | 9-123 | EARGGRDFPPCWADENGKVEFLFQIELKPDSVAVTQAWPPRRETDARALPGIGDVLDTSPHGTAGFISRVAGIFAKSQTLQCRHYVQ… |
| A0A1Y5U512 | 55-200 | QVAELKKELARLDAVANSKGIDPPCWYDEIEADDGRRIERAVPLFDVAVFDNHIVVRDRIPPERYAKERAGLPIGEGIFLRPVSDPE… |
| A0A2D6T193 | 1-136 | None |
| A0A7X4AEU2 | 273-404 | None |
| A0A1W1I6E9 | 127-251 | None |
| A0A2M8RVI8 | 154-341 | None |
| A0A4Y7ZJ52 | 966-1095 | None |
| A0A0Q7AP09 | 213-412 | None |
| A0A2M7CXJ3 | 626-748 | None |
| A0A6N8XY94 | 42-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.