DPCstruct | MC37002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 106 ± 23 aa |
| Standard deviation of domain lengths | 22.81 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564YI63 | 1-109 | MGRVRTKTVKRAARVLIEGYYSKLTRDFHTNKRVTEDVSSVGSKRLRNRIAGFLTHLMRRIQAGPIRGISIKLQEEERERRDNYQPE… |
| A0A7J4UQN8 | 1-58 | MPIKPAYVKRISRELIERYPERFSDDFDENKEAVTLVTNVESKRVRNRIAGYVTRKNR |
| K4AIU7 | 34-160 | None |
| A0A7K4NM03 | 2-81 | None |
| A0A3M9ZN79 | 8-123 | None |
| A0A533UHA3 | 1-69 | None |
| L9KIQ8 | 2-110 | None |
| A0A0D3CLD8 | 1-122 | None |
| A0A813FJ54 | 527-639 | None |
| A0A183B0W4 | 5-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.