DPCstruct | MC3700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 20.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8YBC8 | 1-125 | MIVRGELAEARSGREERRTALASVVQLTDLHILDAQSPMRFEYVHPLNGSAFRPHETLTTQGLVSLVSRINSLPGGPHTRRAFDAVV… |
| T0Y3J3 | 1-182 | MPWYERGAHPSGTTLAGTIVPSPPGAFGYRRLERRPGEQLLLRTDLGGAEPSPRLRSLATFVHLSDLHVTDAQSPARAEYLDRYGDS… |
| A0A5C4XC26 | 2-177 | None |
| A0A1H8PYC0 | 47-200 | None |
| A0A2T3VBG8 | 61-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.