DPCstruct | MC370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 265 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0B763 | 173-461 | LDNFNYGYPNKPRAATLSAEFLSDVRNAFVEIPAPVRRLLTQKLAGIYFVEDLGGSGFTEQIHDTSKPVAGYIVLDASVLQSRTAND… |
| B8FCL8 | 66-336 | LDNKLNGYPEVPKAASADKTFLKDVKDAVRELPAPVQAQLSKHLAGIFLVRELGTTSLTEVLTVPANEQKGFIVLDVDFISKPVNEW… |
| A0A2R4MB82 | 48-301 | None |
| A0A254Q9G6 | 8-246 | None |
| A0A3D4B9Z9 | 10-286 | None |
| A0A4P8HLU2 | 18-289 | None |
| A0A537M0Q4 | 82-345 | None |
| A0A4Q0T5G3 | 163-444 | None |
| A0A353N4G5 | 45-291 | None |
| Q096I4 | 121-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.