DPCstruct | MC37
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0R1I8 | 289-380 | QEYRELAWKQLSDEDKAHLITAKDEALVELIDAANAAVIPLEGKEQLLEDIRANGGKLVAVTYKTDQDALLGPLTVLFDPETKEVIG… |
| A0A3N9U2V4 | 14-116 | FVVLMVGCSNKATQHDDEFYNVKLVAWEFLKEKGWDGRAKENWETAEVSEVMTDDDYKLIDPSYKGKLVLSVIFEDKENAAIGTPIV… |
| A0A6A8DCQ0 | 64-146 | None |
| A0A2T5SFH8 | 29-134 | None |
| A0A6I6UV51 | 5-95 | None |
| A0A4U1MMU3 | 16-113 | None |
| A0A1C6HVD2 | 177-276 | None |
| A0A6B8RTK3 | 139-224 | None |
| A0A1W7LV95 | 76-162 | None |
| U5MUZ8 | 226-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.