DPCstruct | MC36998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564Y2V4 | 2-89 | QQQMSISNLSTPPSHPANVPLAPSLKNWCSVFYYELNNRVGDVFHASKPKFTVDGFTAPLLSTERFSLGGLSHVNRPPQVDMTRRHIG |
| A8DW81 | 1-66 | APENWCSIAYFELDQQVGEIFKVTSNCPSVTVDGYVDPSGGNRFCLGQLSNVHRTEASERARLHIG |
| A0A814JSF1 | 175-290 | None |
| E4Y741 | 113-220 | None |
| A0A6P8SVY3 | 192-291 | None |
| A0A6V7GYE6 | 265-352 | None |
| T1GAI3 | 25-133 | None |
| A0A482VA25 | 5-101 | None |
| A0A139WG04 | 220-327 | None |
| A0A834Y7F3 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.