DPCstruct | MC36997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 9.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564Y0K5 | 22-144 | VLGSRVITSSSGKVGPMYFKSTDRFSTFLRRVQTIEVGEQLTIENDNCIMNGSTVGSPCKMQPDQTVITFNEVPNYDYLILSSKSEI… |
| A0A0R3WLW8 | 64-181 | VALNAFNQCANSPILWGSRVVAKKSGPSDTMVYQFNGDIDAIIRHGSESRGLNLAKGRCIDTLGRIWGSPCRQEGKYVYLTVTDVRA… |
| A0A0X3PKB0 | 6-139 | None |
| A0A7M3RSL5 | 222-332 | None |
| A0A0R3SP20 | 4-143 | None |
| A0A564ZCC2 | 3-117 | None |
| A0A7M3Q5G8 | 1-116 | None |
| A0A158QHX6 | 674-795 | None |
| A0A564ZEL9 | 3-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.