DPCstruct | MC36992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165T2D0 | 2-154 | SQSVLSIVRTARTLGVIHADIRSPNIMFRRSDLSAVLIDFGYTILRGADMSDATWASKVRSWSSMWGTRLLLKDTLMHDPTPVAYSE… |
| A0A369JZZ6 | 315-470 | NVNIPRADVERASEATLQIMKHLRNLGLWHGDCRPENVLMRSQARHNPVLIDFGISSIKRPTESLAQWMATHDEIQEMRYVLSEAGM… |
| A0A2H3BNA2 | 432-590 | None |
| A0A284RUN5 | 29-184 | None |
| A0A284RUK5 | 67-216 | None |
| A0A284RPC8 | 450-601 | None |
| A0A284RUX9 | 8-162 | None |
| A0A2H3D4A1 | 110-258 | None |
| A0A2H3C4T7 | 268-409 | None |
| A0A2H3CFB3 | 254-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.