DPCstruct | MC3699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6QP80 | 109-243 | PAAGTGPPQWFFITSDSGTGPDGLLPAPTNPGLSTTPGTSTGYQAYVAQTYLNAAGETVPGPQSQLAVTTANQIVAGSPVPFGNAAH… |
| A0A3M2DHA1 | 152-263 | VGIPAPTSAPSLAVGSATGLTGTFQYMYTWVNSTTGLESDWSPLGSITVSNQKVDITLPTTAPAADGVDTKRLYRTFDNGSLFYKVA… |
| A0A522ASP6 | 178-286 | None |
| A0A661NYQ6 | 486-611 | None |
| A0A257QU83 | 170-281 | None |
| A0A3D5P8I0 | 106-240 | None |
| A0A3M0WWB3 | 400-516 | None |
| A0A353VDV3 | 139-263 | None |
| A0A1F2R5M4 | 120-234 | None |
| M6VBW8 | 275-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.