DPCstruct | MC36979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 256 ± 52 aa |
| Standard deviation of domain lengths | 51.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 78.61 |
| Assigned Pfam label(s) | PF19278- PF06032- PF02538- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5EVE5 | 352-588 | DALAGLGRLPDAARWSAPFTPAAAVAFAAARMAYALTRYATRRNIDPGRVALAVMGGTGALLAADIAAAMGLDRVLLPRAPGASGAI… |
| A0A7V5M820 | 29-288 | MEVLEAARAMRKVIDANMVDGISVVSVQRGEDPRKYVMVAAGGAGPVHAASLAKALGIKKILVNRGSSIFCALGSVIADLRHDFVRS… |
| A0A179HN16 | 254-499 | None |
| A0A2V6TNZ6 | 926-1228 | None |
| A0A212DNY4 | 18-229 | None |
| H0EM88 | 351-626 | None |
| A0A317WHJ4 | 355-594 | None |
| E7F6Z6 | 396-742 | None |
| K2S7Q5 | 3-255 | None |
| A0A7J3ZC68 | 102-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.