DPCstruct | MC36974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 368 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 91.24 |
| Assigned Pfam label(s) | CL0123- CL0263- PF18755- CL0167- PF00832 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497FUB7 | 50-170 | VPTPMLIYSIVKNIPRGKLITDKLLREKLAEKYGADFTCPLATGWFIRIVAEYSEEEIKSGKKLSEVAPYWRILRSNGSLYEKFPGG… |
| A0A564TWC2 | 54-153 | DLVTDSPTKRIYEAVKQILKGHVATYRQVAKMAGNEKMSRAVGNALHKNPDPEHIPCFRVVNAKGELAGAFAFGGANVQAELLREDG… |
| A0A538QJH9 | 11-112 | None |
| A0A1X0UKJ1 | 28-116 | None |
| A0A430B0E1 | 48-160 | None |
| A0A7R9L3Q8 | 215-309 | None |
| A0A7R9KNZ6 | 296-415 | None |
| A0A5R9PGL8 | 282-395 | None |
| A0A2E9Y6K4 | 16-122 | None |
| A0A5S5DTA0 | 109-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.